Protein coding transcript 88934

• Transcript: Ll_transcript_344384
• CDS coordinates: 2-412 (+)
• Peptide sequence: SVVMDGGYFRRNYSAMAAAAAAAEADDEEEEEDEEGDEEEEEEMMEDEGRGSEVEEGERDKGKEGMRRLAKAIEKFGEVFERVEGQKLRQMVDLEKQRMQFAKDVEVQRMQMFMDTQVQLERIKRGKRSGSDDMYS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_344384

• Blastp: Trihelix transcription factor ASIL2 from Arabidopsis with 35.77% of identity
• Blastx: Trihelix transcription factor ASIL2 from Arabidopsis with 44.59% of identity
• Eggnog: NA(ENOG410Z419)
• Kegg: Link to kegg annotations (AT3G14180)
• CantataDB: Link to cantataDB annotations (CNT0002199)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419880.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;