Transcript | Ll_transcript_344385 |
---|---|
CDS coordinates | 124-462 (+) |
Peptide sequence | MGVEKQLLRPGTGPKPVKGQNVTVHCTGFGKNGDLSQKFWSTKDPGQQPFTFKIGQGSVIKGWDEGVLGMQIGEVSRLRCSPDYAYGAGGFPAWGIQPNSVLEFEIEVLSAQ* |
ORF Type | complete |
Blastp | Peptidyl-prolyl cis-trans isomerase FKBP12 from Vicia with 90.18% of identity |
---|---|
Blastx | Peptidyl-prolyl cis-trans isomerase FKBP12 from Vicia with 90.18% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418800.1) |
Pfam | FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer