Protein coding transcript 89028

• Transcript: Ll_transcript_344747
• CDS coordinates: 243-611 (+)
• Peptide sequence: MASRLGLPLIIQCLIDFGCELNSITNSGDTSVMICAKYKQEECLKVLAKAGAYFGLVNIAGQSKSSNTSAFLPLMFVAQVGDTEALKTVIESGEFDLDYQDDSGFSAVVLTALKGHVESFRLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_344747

• Blastp: Ankyrin-2 from Mus with 29.27% of identity
• Blastx: Ankyrin-2 from Mus with 33.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (109676)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458879.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;