Protein coding transcript 89029

• Transcript: Ll_transcript_344752
• CDS coordinates: 32-598 (+)
• Peptide sequence: MQIDGGGILRLLLQHASSNSPNCGRTLLHHAILCGNVEAVRTLLEFGADPESPVKTTSKTEFLPIHMASRLGLPLIIQCLIDFGCELNSITNSGDTSVMICAKYKQEECLKVPAKAGADFGLVNIAGQSKSSNTSTFLPLMFVAQAGDTEALKTVIESGEFDLDYQDDSGFCAVVLTALKGHVESFRLL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_344752

• Blastp: E3 ubiquitin-protein ligase mib1 from Danio with 27.96% of identity
• Blastx: E3 ubiquitin-protein ligase mib1 from Danio with 27.96% of identity
• Eggnog: Poly (ADP-ribose) polymerase(ENOG410XP18)
• Kegg: Link to kegg annotations (352910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458879.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;