Protein coding transcript 89046

• Transcript: Ll_transcript_345035
• CDS coordinates: 286-789 (+)
• Peptide sequence: MGIPHSASFASLSPLGEACSRKDLTAIHAVLENLGYKDDEGVTNELSFQMWTDQMQDTLNCKKRGDVAFQQKEFRLAIECYTQFIDAGTMVSPTVFARRSLCHLISDMPQEALNDAMQAQVISPIWHIASYLQSVALAGLGMESEAQAALKDGATLEAKRTGTSKQK*
• ORF Type: complete

Annotations of Ll_transcript_345035

• Blastp: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 71.43% of identity
• Blastx: Probable serine/threonine-protein kinase At5g41260 from Arabidopsis with 71.43% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQTV)
• Kegg: Link to kegg annotations (AT5G41260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461579.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;