Protein coding transcript 89057

• Transcript: Ll_transcript_345029
• CDS coordinates: 702-1211 (+)
• Peptide sequence: MGVQCSTLIPCCVNSQVKASVVETADAENEDRSEVSDSPIFRVFTLEQLKNATSGFAAENIVSEHGEKAPNVVFKGKLESQMRIAVKRFNKNAWPDSRQFLEEARSVGQLRNQRLANLLGCCCEGDERLLVAEYMPNETLAKHLFHCKRSFCACFLSSYYCIEHLISVF*
• ORF Type: complete

Annotations of Ll_transcript_345029

• Blastp: Probable serine/threonine-protein kinase BSK3 from Oryza sativa with 68.92% of identity
• Blastx: Probable serine/threonine-protein kinase BSK3 from Oryza sativa with 68.92% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQTV)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456338.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;