Protein coding transcript 89060

• Transcript: Ll_transcript_345819
• CDS coordinates: 2106-2939 (+)
• Peptide sequence: MWSSDIVITNITLRDSPFWTLHPYDCKNITIKHVTILAPVSKAPNTDGIDPDSCEDMLIEDCYISTGDDAIAIKSGWDQYGIAYGRPSKNIMIRNLVVRSMVSAGVSIGSEMSGGVFNVTVENLLVWDSRRAVRIKTAPGRGGYVRQITYRNLTFENVRVGIVMKTDYNEHPDDGYDRTALPILKDISFITVHGHGVRVPVRIHGSEEIPVRNVTFQDMSIGLTYKKKHIFQCAFVQGRVIGAIFPAPCENLDRYNEQGQLVKHSASHNVTDIDYDF*
• ORF Type: complete

Annotations of Ll_transcript_345819

• Blastp: Probable polygalacturonase from Vitis with 41.79% of identity
• Blastx: Probable polygalacturonase from Vitis with 42.05% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443391.1)
• Pfam: Glycosyl hydrolases family 28 (PF00295.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;