Protein coding transcript 89080

• Transcript: Ll_transcript_344338
• CDS coordinates: 2-679 (+)
• Peptide sequence: DPNDSDSFKNISCQDPRCQLVSSPNPPNKPCEAENQSCPYFYWYGDSSNTTGDFALETFTVNLTAPSGKSELKRVDNVMFGCGHWNRGLFHGAAGLLGLGRGPLSFASQLQSLYGHSFSYCLVDRNSNTSVSSKLIFGEDKELLNHSNLNFTSFVGGGKHNSVDTFYYVHIKSVMVGGEVLEIPEETWHLSKDGSGGTIIDSGTTLSYFSEPAYEIIKVAFMKKIK
• ORF Type: internal

Annotations of Ll_transcript_344338

• Blastp: Aspartic proteinase nepenthesin-2 from Nepenthes with 38.2% of identity
• Blastx: Aspartyl protease family protein 2 from Arabidopsis with 38.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435128.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;