Protein coding transcript 89088

• Transcript: Ll_transcript_344367
• CDS coordinates: 509-1252 (+)
• Peptide sequence: MNLCILQKEARHSPLVMSLIDAPLYMGASLMQDRDLNEYRPSLSSTSRHLPCSHQLCDLSSECKGPKDPCPYKDQYASDNTSSSGFLIEDKLHLASDGRNAAQSSVQASIILGCGRKQSGGYLDGAAPDGLLGLGPGSISVPSLLAKAGLIPNSFSICLNENDSGRILFGDQGHIDQRSTPFLPVEGRLSSYFVGVESICVRSVCLKQTGFQTLIDSGTSFTYLPNEVYEKVVAEDYRPTKPMGVLL*
• ORF Type: complete

Annotations of Ll_transcript_344367

• Blastp: Aspartic proteinase-like protein 1 from Arabidopsis with 58.77% of identity
• Blastx: Aspartic proteinase-like protein 1 from Arabidopsis with 58.77% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G10080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456917.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;