Protein coding transcript 89090

• Transcript: Ll_transcript_344352
• CDS coordinates: 1622-2026 (+)
• Peptide sequence: MIVMKYKLLVQDYTAFCLTVIQTNEDYGTIGQDFLKGYRMVFDRENLRFGWSSSNCQDSMGDTENLTSASHSGSPNSLPANQQQTIPNTPAVPPAVAGKTSPKPSIVTASRHTSWHLLSSLSLIFIYGYLVKLM*
• ORF Type: complete

Annotations of Ll_transcript_344352

• Blastp: Aspartic proteinase-like protein 1 from Arabidopsis with 44.94% of identity
• Blastx: Aspartic proteinase-like protein 1 from Arabidopsis with 55.89% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G10080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456917.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;