Transcript | Ll_transcript_344363 |
---|---|
CDS coordinates | 2469-2912 (+) |
Peptide sequence | MKFTFSKNQTFLIQNPLLTFPGSQDYTAFCLTVIQTNEDYGTIGQDFLKGYRMVFDRENLRFGWSSSNCQDSMGDTENLTSASHSGSPNSLPANQQQTIPNTPAVPPAVAGKTSPKPSIVTASRHTSWHLLSSLSLIFIYGYLVKLM* |
ORF Type | complete |
Blastp | Aspartic proteinase-like protein 1 from Arabidopsis with 45.54% of identity |
---|---|
Blastx | Aspartic proteinase-like protein 1 from Arabidopsis with 52.51% of identity |
Eggnog | aspartic(ENOG410XNV7) |
Kegg | Link to kegg annotations (AT5G10080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456918.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer