Protein coding transcript 89202

• Transcript: Ll_transcript_345984
• CDS coordinates: 686-1471 (+)
• Peptide sequence: MKTFYSILLSRNVVVIFVVQFHNFFCTKLSKSCSSLLVFQGKALHWTRAYHLKMPPPPLPPQPPRGGPRQRFLRTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAVDGSLVHSLTGHTASSYVLDVHPFNPRIAMSAGYDGRAIVWDIWEGVPIRTYEIGRFKLVDGKFSPDGTSIVLSDDVGQIYFLNTGQGESQKDAKYDQFFLGDYRPLIQDTQGNVLDQETQLPPHRRNLQEPLCDSSMMWLCKNFAFLFVYKFILS*
• ORF Type: complete

Annotations of Ll_transcript_345984

• Blastp: Bromodomain and WD repeat-containing DDB_G0285837 from Dictyostelium with 37.28% of identity
• Blastx: Bromodomain and WD repeat-containing DDB_G0285837 from Dictyostelium with 39.49% of identity
• Eggnog: bromodomain and WD repeat domain containing(ENOG410YCD8)
• Kegg: Link to kegg annotations (DDB_G0285837)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452358.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;