Protein coding transcript 89212

• Transcript: Ll_transcript_345993
• CDS coordinates: 2-1129 (+)
• Peptide sequence: NTIAFSPRPSAIYQLLSSSDDGTCRLWDARYSQRNPRIYLPKPPDATTGKSNAPPANQPSSSNGQQSYQILCCAYNANGTVFVTGSSDTFARVWSAFNFKPNSDDSEQPIHEMDLLTGHENDVNYVQFSGCSVASKFLTSDPWKEENTVKFRNSWFCHDNIVTCSRDGSAIIWIPRSRRSHGKALRWTRAYHLKVPSPPLPPQPPRGGPRQRFLPTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAVDGSLVHSLTGHTASSYVLDVHPFNPRIAMSAGYDGRAIVWDIWEGVPIRTYEIGRFKLVDGKFSPDGTSIVLSDDVGQIYFLNTGQGESQKDAKYDQFFLGDYRPLIQDTQGNVLDQVESNHYAIEHC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_345993

• Blastp: PH-interacting protein from Homo with 30.05% of identity
• Blastx: PH-interacting protein from Homo with 28.68% of identity
• Eggnog: bromodomain and WD repeat domain containing(ENOG410YCD8)
• Kegg: Link to kegg annotations (55023)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452357.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;