Transcript | Ll_transcript_345995 |
---|---|
CDS coordinates | 3-878 (+) |
Peptide sequence | VNTIRFSPRPSAVYQLLSSSDDGTCRLWDARYSQRNPRIYLPKPPEATTGKSNAPPANQPSSSNGQQSCRILCCAYNATGTAFVTGSSDTFARVWSVFNFKPNSDESEQPIHEIDLLTGHENDVNHVQFSGCSVASKFLTSDSWKEENTMKFRNSWFSHDNIVTCSRDGSAIIWVPRSRRSHGKALHWTRAYHLKMPPPPLPPQPPRGGPRQRFLRTPRGVNMIVWSLDNRFVLAAIMDCRICVWNAVDGSLVHSLTGHTASSYVLDVHPFNPRIAMSAGYDGRAIVWDIWE |
ORF Type | internal |
Blastp | PH-interacting protein from Mus with 27.61% of identity |
---|---|
Blastx | PH-interacting protein from Mus with 27.27% of identity |
Eggnog | bromodomain and WD repeat domain containing(ENOG410YCD8) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441308.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer