Transcript | Ll_transcript_345976 |
---|---|
CDS coordinates | 2-817 (+) |
Peptide sequence | NTIAFSPRPSAIYQLLSSSDDGTCRLWDARYSQRNPRIYLPKPPDATTGQTTASCSVNRPSQYGKSNAPPANQPSSSNGQQSYQILCCAYNANGTVFVTGSSDTFARVWSAFNFKPNSDDSEQPIHEMDLLTGHENDVNYVQFSGCSVASKFLTSDSLKEENTMKFRNSWFCHDNIVTCSRDGSAIIWVPRSRRSHGKALHWTRAYHLKVPPPPLPPQPPRGGPRKRFLPTPRGVDMIVWSLDNRFVLAAITDCRICVWNAVDGSLVHSLTG |
ORF Type | internal |
Blastp | PH-interacting protein from Homo with 24.45% of identity |
---|---|
Blastx | Bromodomain and WD repeat-containing protein 1 from Mus with 25.93% of identity |
Eggnog | bromodomain and WD repeat domain containing(ENOG410YCD8) |
Kegg | Link to kegg annotations (55023) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428466.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer