Protein coding transcript 89220

• Transcript: Ll_transcript_345979
• CDS coordinates: 1814-2497 (+)
• Peptide sequence: MSAGYDGRAIVWDIWEGVPIRTYEIGRFKLVDGKFSPDGTSIVLSDDVGQIYFLNTGQGESQKDAKYDQFFLGDYRPLIQDTQGNVLDQETQLPPHRRNLQEPLCDSSMVPYPEPYQSQFQRRRLGALGIEWHPSLIKCAVGPDFSVGLDYPVIPLADLDGMLEPQPQFIDAMFWEPEFDIVVSDDNDSEYYVNEDSSNAGEQGSVCASSSDSECSEDDSSNRDGLRR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345979

• Blastp: Bromodomain and WD repeat-containing DDB_G0285837 from Dictyostelium with 36% of identity
• Blastx: Bromodomain and WD repeat-containing DDB_G0285837 from Dictyostelium with 36.69% of identity
• Eggnog: bromodomain and WD repeat domain containing(ENOG410YCD8)
• Kegg: Link to kegg annotations (DDB_G0285837)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452358.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;