Protein coding transcript 89221

• Transcript: Ll_transcript_345980
• CDS coordinates: 2-805 (+)
• Peptide sequence: NTIAFSPRPSAIYQLLSSSDDGTCRLWDARYSQRNPRIYLPKPPDATTGKSNAPPANQPSSSNGQQSYQILCCAYNANGTVFVTGSSDTFARVWSAFNFKPNSDDSEQPIHEMDLLTGHENDVNYVQFSGCSVASKFLTSDSLKEENTMKFRNSWFCHDNIVTCSRDGSAIIWVPRSRRSHGKALHWTRAYHLKVPPPPLPPQPPRGGPRKRFLPTPRGVDMIVWSLDNRFVLAAITDCRICVWNAVDGSLVHSLTGHTASSYVLDVH
• ORF Type: internal

Annotations of Ll_transcript_345980

• Blastp: PH-interacting protein from Homo with 26.3% of identity
• Blastx: Bromodomain and WD repeat-containing protein 1 from Mus with 26.5% of identity
• Eggnog: bromodomain and WD repeat domain containing(ENOG410YCD8)
• Kegg: Link to kegg annotations (55023)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452357.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;