Protein coding transcript 89270

• Transcript: Ll_transcript_346874
• CDS coordinates: 125-619 (+)
• Peptide sequence: MATTIGRVLVPTRLVSNNTINVTTCYAFPYLPHRFSNTLSSSHSLKHLSESRKFSLLQTRASSSDETSTSVDTNELFNDLKEKWDALENKSTVVVYGGGAIVAVWLSSTLVGALNTVPLLPKILELVGLGYTGWFVYRYLLFKSSRKELVTDIEDLKKKIGGNE*
• ORF Type: complete

Annotations of Ll_transcript_346874

• Blastp: Protein CURVATURE THYLAKOID 1A, chloroplastic from Arabidopsis with 68.75% of identity
• Blastx: Protein CURVATURE THYLAKOID 1A, chloroplastic from Arabidopsis with 64.58% of identity
• Eggnog: NA(ENOG4111YWG)
• Kegg: Link to kegg annotations (AT4G01150)
• CantataDB: Link to cantataDB annotations (CNT0000897)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423922.1)
• Pfam: CAAD domains of cyanobacterial aminoacyl-tRNA synthetase (PF14159.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;