Transcript | Ll_transcript_329340 |
---|---|
CDS coordinates | 3-305 (+) |
Peptide sequence | FLEIAPGINLRHSPGHTPGLAIMQVNLADSGTFIFTTDQYHVKENWESDAPQGWLARDHDDWCTSHQMIKGLAKRTNANVVLGHCAETFWKYKIAPDSYT* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | N-acyl homoserine lactonase from Arthrobacter with 34.12% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAP57766) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016168880.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer