Transcript | Ll_transcript_344468 |
---|---|
CDS coordinates | 1-798 (+) |
Peptide sequence | EHYFPHTLSLFLIFFLFLFSLSSFFSVTDLDLSCLQTRVDSTIIHIFILHQQKKMGIFFIPKATSCILFLFLMSCTCFISTDAYDPLDPNGNITIKWDIISWTPDGYVAAVTMNNFQQYRHIASPGWSLGWTWAKKEVIWSMMGGQTTEQGDCSKFKGTPPHCCKKDPTVVYSVSSFQVSVGRAGTTNKTVKVPKNFTLKAPGPGYTCSPAKIVTPTLFIQADKRRVTQALMTWNVTCTYSQFLAQKTPSCCVSLSSFYNDTIVP* |
ORF Type | 5prime_partial |
Blastp | COBRA-like protein 1 from Arabidopsis with 68.72% of identity |
---|---|
Blastx | COBRA-like protein 1 from Arabidopsis with 65.31% of identity |
Eggnog | cobra-like protein(ENOG410YAAC) |
Kegg | Link to kegg annotations (AT3G02210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456436.1) |
Pfam | COBRA-like protein (PF04833.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer