Protein coding transcript 89370

• Transcript: Ll_transcript_345617
• CDS coordinates: 1313-2323 (+)
• Peptide sequence: MLSCPFFDFHNLPFFLPLQLEVKDVYLSYLPLAHIFDRVIEEAFIWHGASIGFWRGDVKLLIEDLGELKPTIFCAVPRVLDRVYSGLTQKISGGGFLKQTLFNFAHSFKLNNMKKGHPHAEASPFFDKLVFDKIKQGLGGKVRLILSGAAPLSTHVESYLRVVTCSHVLQGYGLTETCAGTFVSLPNELGMLGTVGPPVPNVDVCLESVPEMGYDALGSTPRGEICVRGNTLFSGYYKREDLTKEVLIDGWFHTGDIGEWQPNGSMKIIDRKKNIFKLSQGEYVAVENLENIYDQLSSIESVCPKNPFNGFAILVCGAFFAYKKFGKYMVNYLLVI*
• ORF Type: complete

Annotations of Ll_transcript_345617

• Blastp: Long chain acyl-CoA synthetase 4 from Arabidopsis with 78.86% of identity
• Blastx: Long chain acyl-CoA synthetase 4 from Arabidopsis with 78.86% of identity
• Eggnog: Amp-dependent synthetase and ligase(COG1022)
• Kegg: Link to kegg annotations (AT4G23850)
• CantataDB: Link to cantataDB annotations (CNT0000270)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420966.1)
• Pfam: AMP-binding enzyme (PF00501.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;