Protein coding transcript 89402

• Transcript: Ll_transcript_345846
• CDS coordinates: 351-1418 (+)
• Peptide sequence: MRGQGLRLNKGLEVQRAGGVGFILGNNEKYGNDVPFDPHFIPATGVSYENVFKIIQYIQSSPNPMAHFLPGKTVLKAKPAPSMASFSSRGPNVIDPYILKPDITAPGVYILAAWTAEDGPTRMTFHDKRVVKFNIFSGTSMSCPHVSAAAVLLKAIHPTWSSAAIRSALITTAVTTDNTGNPMTDETRNPANPFAMGSGHFNPKKAADPGLVYDASYIDYFIYTCHLGIAQNLTITDKCPNSLQEPFDLNYPSIQVHKLNVTGTIRRSVTNVGKRRIVYKFIANSPKEYKITATPNILRFNHVGQKINFTITVTARKGHIANKTDPYQYYFGWYAWTHKHYIVKSQVAVSFDSFP*
• ORF Type: complete

Annotations of Ll_transcript_345846

• Blastp: Subtilisin-like protease SBT5.6 from Arabidopsis with 54.96% of identity
• Blastx: Subtilisin-like protease SBT5.6 from Arabidopsis with 55.26% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT5G45650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419897.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;