Protein coding transcript 89482

• Transcript: Ll_transcript_346216
• CDS coordinates: 1124-1828 (+)
• Peptide sequence: MDNNALAYGGGGGMKRSHHSSGNLSLFWKEQQVMPEVVVDSPDVSDILSDEEDDSFLELPNNQDGNMKSYPKYVRIVSKQMVGIYVSIWVQRKLRRHINNLKVSPVGIGLMGYMGNKGSVSVSMSLFQSRLCFVCSHLTSGQKDGAEQKRNSDVHEILRRTCFSSVFDKDQPQTIPLHDKIFWFGDLNYRMNMLDVEIRKLVALKKWNELMNYDQVKFKKPTPTFWSVKSKVLI*
• ORF Type: complete

Annotations of Ll_transcript_346216

• Blastp: Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 74.67% of identity
• Blastx: Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 49.5% of identity
• Eggnog: inositol(COG5411)
• Kegg: Link to kegg annotations (AT4G18010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433331.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;