Protein coding transcript 89502

• Transcript: Ll_transcript_346238
• CDS coordinates: 1693-2118 (+)
• Peptide sequence: MHGSVSVSISLFQSRLCFVCSHLSSGQKDGQRRNSDVHEILRRTCFSSVFDPDQPQTISSHDQIFWFGDLNYRINMLDVEVRKLVALKKWDALMKSDQLCKEMRPGHVFDGWKEGFINFPPTYKYEFNSDRYVGENPKEGEK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_346238

• Blastp: Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 71.13% of identity
• Blastx: Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 65.64% of identity
• Eggnog: inositol(COG5411)
• Kegg: Link to kegg annotations (AT4G18010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445002.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;