Protein coding transcript 89590

• Transcript: Ll_transcript_345093
• CDS coordinates: 648-1277 (+)
• Peptide sequence: MSSNGCSIVWFRRDLRVEDNPALMAGVRAGAVVAVFIWAPEEEGQYQPGRVSRWWLKQSLAYLDSSLRNLGTPLITKRSTDSVSALLEVVKSTGATQLFFTHLYDPLSLIRDHRAKEVLTAHGITVRSFNSDLLYEPWDVNDDHGQPFTTFDAFWERCLNMPYDPPAPFLPPKRIIPGLLLLNSFLILIFLLTLLVILIGGYALNLLKT*
• ORF Type: complete

Annotations of Ll_transcript_345093

• Blastp: Cryptochrome-1 from Arabidopsis with 78.36% of identity
• Blastx: Cryptochrome-1 from Arabidopsis with 78.44% of identity
• Eggnog: deoxyribo-dipyrimidine photolyase(COG0415)
• Kegg: Link to kegg annotations (AT4G08920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430904.1)
• Pfam: DNA photolyase (PF00875.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;