| Transcript | Ll_transcript_344928 |
|---|---|
| CDS coordinates | 231-590 (+) |
| Peptide sequence | MVSSTLCHHSLNPSMASFTTTHLSIPMYKRISLHMPPFVNYRYHLGNITTKQITTLKAVKAKVSEEAVSENDGTPQKKKLRVLVVGGGIRGLVFALAAKRMRFEVVVFERDMSAIRGEG* |
| ORF Type | complete |
| Blastp | Zeaxanthin epoxidase, chloroplastic from Prunus with 49.17% of identity |
|---|---|
| Blastx | Zeaxanthin epoxidase, chloroplastic from Prunus with 57.99% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423349.1) |
| Pfam | NAD(P)-binding Rossmann-like domain (PF13450.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer