Protein coding transcript 89713

• Transcript: Ll_transcript_345812
• CDS coordinates: 216-635 (+)
• Peptide sequence: MHLLTFHYYSTFIGYQYHNIHKDPPSFFSLFSLSILHYSIWCLRERERNSAWENMESNSVCKFMFAFFCLALCLVPHLVHSTVTYDRKAILINGQRRILFSGSIHYPRSTPDMWEDLIYKAKEGGLDVIETYACLLECS*
• ORF Type: complete

Annotations of Ll_transcript_345812

• Blastp: Beta-galactosidase 3 from Arabidopsis with 74.29% of identity
• Blastx: Beta-galactosidase 3 from Arabidopsis with 85.45% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT4G36360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421219.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;