Protein coding transcript 89717

• Transcript: Ll_transcript_345804
• CDS coordinates: 427-1287 (+)
• Peptide sequence: MEALMLLTLMSSGMFMNLHLAMYYYGSFLVQFYTFLVQILKPHLTCSLFFSLSIFCYFSDVGLQYNFEGRYDLVRFIKTVQKVGLYVNLRIGPYVCAEWNFGGFPVWLKYVPDISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEFGPVSKALGAAGRSYTNWAAEMAVGLGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPTLWTEAWSGWFTEFGGPIVQRPVEDLAFAVARFLQKGGSYFNYYMYHGGTNFGRSAGGPFITTS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345804

• Blastp: Beta-galactosidase 5 from Arabidopsis with 86.1% of identity
• Blastx: Beta-galactosidase 5 from Arabidopsis with 86.1% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT1G45130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458145.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;