Transcript | Ll_transcript_345806 |
---|---|
CDS coordinates | 328-1107 (+) |
Peptide sequence | METISVSKLLTLYFFTVLFLCSNLIQCTVTYDRKAIVINGQRRILISGSIHYPRSTPEMWEDLIEKAKHGGLDVIDTYVFWNVHEPSPGNYNFEGRYDLVRFIKTVQKVGLYVNLRIGPYVCAEWNFGGFPVWLKYVPDISFRTDNGPFKAAMQGFTQKIVQMMKNEKLFQSQGGPIILSQIENEFGPVSKALGAAGRSYTNWAAEMAVGLGTGVPWVMCKEDDAPDPVINTCNGFYCDYFTPNKPYKPTLWTEAWSGW* |
ORF Type | complete |
Blastp | Beta-galactosidase 5 from Arabidopsis with 81.71% of identity |
---|---|
Blastx | Beta-galactosidase 5 from Arabidopsis with 85.77% of identity |
Eggnog | beta-galactosidase(COG1874) |
Kegg | Link to kegg annotations (AT1G45130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458145.1) |
Pfam | Glycosyl hydrolases family 35 (PF01301.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer