Protein coding transcript 89721

• Transcript: Ll_transcript_404677
• CDS coordinates: 78-557 (+)
• Peptide sequence: MKPMMMMLPSKSSRKNKSSSKENHPPSSDPNVLINPKPSPLKSNHSLPPRPPSSSKRTKLTTDLNNSPSSDSGVKVVVRMRPLCKDKDEEDPIVQKISTNSLSINGHTFTFDSVADVEATQVDIFEHVGVPVVENCLAGFNSSVFAYGQTGSGKTYTMWG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_404677

• Blastp: Kinesin-like protein KIN-12B from Arabidopsis with 60.25% of identity
• Blastx: Kinesin-like protein KIN-12B from Arabidopsis with 72.53% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G23670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438283.1)
• Pfam: Microtubule binding (PF16796.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;