Transcript | Ll_transcript_402531 |
---|---|
CDS coordinates | 375-992 (+) |
Peptide sequence | MLSGLMNFLGACFQPSLERYAHTGSEAGGRQDGLLWYKDSGQHVHGEFSMAVVQANNLLEDQSQVESGTLSSNEFGPHGTFIGVYDGHGGPETSRFINDHLFHHLKRFTSEQQSMSTDVIRKAFQATEDAFMSLVARQWSVKPQIAAVGSCCLVSVICNGTLYVANAGDSRAVLGRVVKATGEVLATQLSTEHNASIESVRQELHS |
ORF Type | 3prime_partial |
Blastp | Probable protein phosphatase 2C 64 from Arabidopsis with 73.3% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 64 from Arabidopsis with 73.3% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (AT4G38520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452610.1) |
Pfam | Protein phosphatase 2C (PF00481.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer