Protein coding transcript 89812

• Transcript: Ll_transcript_402538
• CDS coordinates: 1402-1992 (+)
• Peptide sequence: MSVDVIRKAFQATEDAFMSLVARQWSMKPQIAAVGSCCLVAVICNGTLYIANAGDSRAVMGRVVKATGEVLATQLSTEHNASIESVRQELHSLHPDDPNIVVLKHNVWRVKGIIQVSRSIGDVYLKKAEFNREPLYVKFRLREPFKRPILSSEPSITVHQLQPHDQFVILASDGLWEHLSNQEAVDIVANNPHSVR*
• ORF Type: complete

Annotations of Ll_transcript_402538

• Blastp: Probable protein phosphatase 2C 28 from Oryza sativa with 79.69% of identity
• Blastx: Probable protein phosphatase 2C 28 from Oryza sativa with 77.89% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (4331548)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441719.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;