Protein coding transcript 89952

• Transcript: Ll_transcript_404137
• CDS coordinates: 291-809 (+)
• Peptide sequence: MASELSLVKPISKFTYVTPKFTTPTMFSYSKFSTIKMSATTTSTSTKPSKKSNKTAIKETLLTPRFYTTDFDEMETLFNTEINKNLNNNEFEALLQEFKTDYNQTHFVRNKEFKEAADKLDGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKVCAFVFLWFVFELSFGGE*
• ORF Type: complete

Annotations of Ll_transcript_404137

• Blastp: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Euphorbia sect. Esula with 80.62% of identity
• Blastx: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 81.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458029.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;