Transcript | Ll_transcript_404130 |
---|---|
CDS coordinates | 2-436 (+) |
Peptide sequence | YSKFSTIRMSATTTSTSTKPSKKSNKTAIKETLLTPRFYTTDFDEMETLFNTEINKNLNNNEFEALLQEFKTDYNQTHFVRNKEFKEAADKLDGPLRQIFVEFLERSCTAEFSGFLLYKELGRRLKVCAFVFLWFVFELSFGGE* |
ORF Type | 5prime_partial |
Blastp | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Euphorbia sect. Esula with 87.7% of identity |
---|---|
Blastx | Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 77% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456731.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer