Protein coding transcript 90030

• Transcript: Ll_transcript_404882
• CDS coordinates: 925-1239 (+)
• Peptide sequence: MILQGRLLMEEQLNSHDQFRDWRLDVDNMSYEQLLELGEKIGYVNTGLEEDEMRLNIRKLKFVISNGISKNQMDKKCTICQQEYEGGEELGRLNCEHKYHFQCIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_404882

• Blastp: E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 46.46% of identity
• Blastx: E3 ubiquitin-protein ligase MBR2 from Arabidopsis with 40.44% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G34040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443281.1)
• Pfam: RING-like zinc finger (PF17123.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;