Transcript | Ll_transcript_404913 |
---|---|
CDS coordinates | 162-734 (+) |
Peptide sequence | MEHQTRLTMFLPNLVLLLIFFLHSTTWTTAQEVENETEFDYIKGSKKGPPHWGDLKKEWGACKNGNMQSPIDLSRHNVRVVSGLGKLKKNYKAQNASITNRGHDIALKWEKDAGSIIINGINFFLRQCHWHSPSEHTINGRRYDLELHMVHESKGNLKNRIAVIGLLFKIGRPDPILSKVIFYSFCSSNF* |
ORF Type | complete |
Blastp | Alpha carbonic anhydrase 7 from Arabidopsis with 56.85% of identity |
---|---|
Blastx | Alpha carbonic anhydrase 7 from Arabidopsis with 56.85% of identity |
Eggnog | Carbonic anhydrase(COG3338) |
Kegg | Link to kegg annotations (AT1G08080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443083.1) |
Pfam | Eukaryotic-type carbonic anhydrase (PF00194.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer