Protein coding transcript 90041

• Transcript: Ll_transcript_404903
• CDS coordinates: 162-929 (+)
• Peptide sequence: MEHQTRLTMFLPNLVLLLIFFLHSTTWTTAQEVENETEFDYIKGSKKGPPHWGDLKKEWGACKNGNMQSPIDLSRHNVRVVSGLGKLKKNYKAQNASITNRGHDIALKWEKDAGSIIINGINFFLRQCHWHSPSEHTINGRRYDLELHMVHESKGNLKNRIAVIGLLFKIGRPDPILSKFSKYIKSMVDEKAEKNTGIIDPSEIKLGGKKYYRYMGSLTVPPCTEGVIWSINKKVQVNNMQFTFITKKNIFGKRK*
• ORF Type: complete

Annotations of Ll_transcript_404903

• Blastp: Alpha carbonic anhydrase 7 from Arabidopsis with 55.34% of identity
• Blastx: Alpha carbonic anhydrase 7 from Arabidopsis with 55.34% of identity
• Eggnog: Carbonic anhydrase(COG3338)
• Kegg: Link to kegg annotations (AT1G08080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443083.1)
• Pfam: Eukaryotic-type carbonic anhydrase (PF00194.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;