Protein coding transcript 90045

• Transcript: Ll_transcript_403265
• CDS coordinates: 488-1603 (+)
• Peptide sequence: MSLYPFHVPNTSVPIIELVSSCICIFVIILFYFDFLYRRIRETITQYKGNLVLELQQRSIEFSSIIAKHQSIRSTLVDRMPVLNEATFIGKRAGSLPDAASIQSGPSVNLPNGVAKPSAPLLDLLDLSSDEAPAPSSSGGDLIQDLLGVDLSMPSQQSGASQSSKSGTDVLLDLLSIGSPPAPTQSPSVQNNSSIIDVLSPDTTKKPSDSPLDDLSSLSLSSRGTSNGGAAPMMDSLDALPTSPPAENNGPVYPSITAFESNFLRLIFDFSKQTGNLQTTNIQATFTNLSSNVYTDFVFQAAVPKFLQLQLDPASSNTLPASGNGSITQSMRVTNSQYGKKSVVMRIRIAYKINGKDTLEEGQISNFPRDL*
• ORF Type: complete

Annotations of Ll_transcript_403265

• Blastp: AP-1 complex subunit gamma-2 from Arabidopsis with 58.51% of identity
• Blastx: AP-1 complex subunit gamma-1 from Arabidopsis with 56.56% of identity
• Eggnog: Adaptor-related protein complex(ENOG410XPKK)
• Kegg: Link to kegg annotations (AT1G60070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439200.1)
• Pfam: Adaptin C-terminal domain (PF02883.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;