Transcript | Ll_transcript_404416 |
---|---|
CDS coordinates | 114-452 (+) |
Peptide sequence | MTVIILILSSWVISVPVFCSNMHFKSYFFCRVAFRQSLAFWKEKIGHTTIDLGIAQDKIESYHNGDIKHTDPLDRLASVRGHLVSFPLEFMCQENLRPAFNESEYYASQVFH* |
ORF Type | complete |
Blastp | Phospholipase D zeta 1 from Arabidopsis with 65.05% of identity |
---|---|
Blastx | Phospholipase D zeta 1 from Arabidopsis with 65.05% of identity |
Eggnog | Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol (By similarity)(COG1502) |
Kegg | Link to kegg annotations (AT3G16785) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419033.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer