Protein coding transcript 901

• Transcript: Ll_transcript_504550
• CDS coordinates: 2-301 (+)
• Peptide sequence: DHQDGPVPEIKPCRFTGSEVRLRDDAIPLAHVAIAVEGCGWTDADNIPLMVANTLLGAWDRSQGGGANNASQLAAVTAEDEAAHSFQSFNTCYKDTGLWG
• ORF Type: internal

Annotations of Ll_transcript_504550

• Blastp: Mitochondrial-processing peptidase subunit beta from Rattus with 62.24% of identity
• Blastx: Mitochondrial-processing peptidase subunit beta from Rattus with 62.24% of identity
• Eggnog: peptidase'(COG0612)
• Kegg: Link to kegg annotations (64198)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003532256.1)
• Pfam: Peptidase M16 inactive domain (PF05193.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;