Transcript | Ll_transcript_402914 |
---|---|
CDS coordinates | 36-503 (+) |
Peptide sequence | MVFTKYEIAFGDSDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTAPSLAIPKAISNAGLEASQIDFYEVNEAFAVVALANQKLLGLDSEKVNVHGGAVALGHPLGCSGACILVTILGLFAKINKLCLPLWYMHTIVAARNITNATP* |
ORF Type | complete |
Blastp | Acetyl-CoA acetyltransferase, cytosolic 1 from Arabidopsis with 79.17% of identity |
---|---|
Blastx | Acetyl-CoA acetyltransferase, cytosolic 1 from Arabidopsis with 79.17% of identity |
Eggnog | acetyl-coa acetyltransferase(COG0183) |
Kegg | Link to kegg annotations (AT5G48230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456499.1) |
Pfam | Thiolase, C-terminal domain (PF02803.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer