| Transcript | Ll_transcript_404259 |
|---|---|
| CDS coordinates | 307-690 (+) |
| Peptide sequence | MFGRAPKKSDNSRYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGGPFGGMIMINAFLIKICVLHNCLL* |
| ORF Type | complete |
| Blastp | DnaJ protein homolog from Cucumis with 90.62% of identity |
|---|---|
| Blastx | DnaJ protein homolog from Cucumis with 93.75% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453819.1) |
| Pfam | DnaJ domain (PF00226.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer