Protein coding transcript 90281

• Transcript: Ll_transcript_404266
• CDS coordinates: 53-463 (+)
• Peptide sequence: MFGRAPKKSDNSRYYEILGVSKSASQDDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGGGPFGGGSSRGRRQRRGEDVVHPLKVSWEDLYSGT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_404266

• Blastp: Chaperone protein dnaJ 2 from Arabidopsis with 86.23% of identity
• Blastx: DnaJ protein homolog from Cucumis with 85.4% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT5G22060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453819.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;