Protein coding transcript 90368

• Transcript: Ll_transcript_403068
• CDS coordinates: 1-306 (+)
• Peptide sequence: VSVVEACHSLGVMHRDLKPENFLFVDEKEDSMLKAIDFGMSVFFKPGDVFTDMVGSPYYIAPEVLRKSYGPEADVWSAGVIIYILLCGTPPFWGGKSSYDIT
• ORF Type: internal

Annotations of Ll_transcript_403068

• Blastp: Calcium-dependent protein kinase 27 from Oryza sativa with 80.49% of identity
• Blastx: Calcium-dependent protein kinase 27 from Oryza sativa with 80.85% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424954.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;