Protein coding transcript 90371

• Transcript: Ll_transcript_403079
• CDS coordinates: 1-582 (+)
• Peptide sequence: VSVVEACHSLGVMHRDLKPENFLFVDEKEDSMLKAIDFGMSVFFKPGDVFTDMVGSPYYIAPEVLRKSYGPEADVWSAGVIIYILLCGTPPFWGESEQEIFEEVLDGDLDFSSDPWPTISESAKDLVRKMLVRDPRNRLTAHEVLCHPWIQVDGVAPDKPLNSAVLSRLKQFSAMNKLKKMALRVRNLLSHNSL
• ORF Type: internal

Annotations of Ll_transcript_403079

• Blastp: Calcium-dependent protein kinase 1 from Arabidopsis with 84.39% of identity
• Blastx: Calcium-dependent protein kinase 1 from Arabidopsis with 84.86% of identity
• Eggnog: calcium-dependent protein kinase(ENOG410XRMJ)
• Kegg: Link to kegg annotations (AT5G04870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424954.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;