Protein coding transcript 90386

• Transcript: Ll_transcript_402271
• CDS coordinates: 3-719 (+)
• Peptide sequence: ALAEEIEFFKEGLIVGKTKDDCQDQWKKAFTNCFLKVDAVVGGSSNCNSVAPENVGSAAVVAVICSSHIIVSNCGDSRAVLCHGKEPMALSVDHKPNRDDEHARIEAAGGKVIQWNGHRVLGVLAMSRSIGDRYPKPWIIPEPEVSFLPRAKDDECLILASDGPWDVMTNEEACHIARRRIFIWHNKNGSALPSVRGEEIDPAAQAAAEYLLNCALQKGSKDNITVIVVDLKAQRKFKT
• ORF Type: internal

Annotations of Ll_transcript_402271

• Blastp: Protein phosphatase 2C 16 from Arabidopsis with 67.07% of identity
• Blastx: Protein phosphatase 2C 16 from Arabidopsis with 67.07% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT1G72770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417764.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;