Transcript | Ll_transcript_402275 |
---|---|
CDS coordinates | 3-308 (+) |
Peptide sequence | ALAEEIEFFKEGLIVGKTKDDCQDQWKKAFTNCFLKVDAVVGGSSNCNSVAPENVGSAAVVAVICSSHIIVSNCGDSRAVLCRGKEPMALSVDHKVGYLQL* |
ORF Type | 5prime_partial |
Blastp | Protein phosphatase 2C 7 from Arabidopsis with 57.55% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 6 from Oryza sativa with 59.18% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (AT1G17550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415431.1) |
Pfam | Protein phosphatase 2C (PF00481.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer