Protein coding transcript 90393

• Transcript: Ll_transcript_402264
• CDS coordinates: 2-442 (+)
• Peptide sequence: GSQVANYCRDRLHLALAEEIEFFKEGLIVGNTKDDCQDQWKKAFTNSFLKVDAEVGGNANYEPVAPETVGSTAVVAIICSSHIIVANCGDSRVVLCRGKEPMALSVDHKPNRDDEYARIEAAGGKVIQWNGHRVFGVLAMSRSIGM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_402264

• Blastp: Probable protein phosphatase 2C 6 from Oryza sativa with 70.95% of identity
• Blastx: Probable protein phosphatase 2C 6 from Oryza sativa with 70.95% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (4324201)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415431.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;