| Transcript | Ll_transcript_293662 |
|---|---|
| CDS coordinates | 2-325 (+) |
| Peptide sequence | IVAADVPESDLKLDLKEQSLSFKGTSTSKKCTYAIDLEFFAEIDPKESKISHSGRDVTMVLRKKEMKEEFWPRLLKDTKKMHFLKTNFDKWVDEDEQDEAPEDESMNQ |
| ORF Type | internal |
| Blastp | Protein wos2 from Schizosaccharomyces with 44.9% of identity |
|---|---|
| Blastx | Protein wos2 from Schizosaccharomyces with 42.05% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC9E9.13) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020223132.1) |
| Pfam | CS domain (PF04969.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer