| Transcript | Ll_transcript_445088 |
|---|---|
| CDS coordinates | 2-331 (+) |
| Peptide sequence | DSTTASLSIANSDLPGPTLDLNSLITSFSDKGFTAQELVALSGAHTIGKARCQFFRARIFNETNIDSSFATSLQANCPSTGGDDNLANLDVTTPNTFDNVYFKNLQSKKG |
| ORF Type | internal |
| Blastp | Cationic peroxidase 1 from Arachis with 68.18% of identity |
|---|---|
| Blastx | Cationic peroxidase 1 from Arachis with 68.18% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450387.1) |
| Pfam | Peroxidase (PF00141.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer